PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01809.1.p
Common NameEUGRSUZ_D01809, LOC104441711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 208aa    MW: 23081.4 Da    PI: 9.8298
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01809.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.26.2e-32128186159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+++r ++d ++v++tYeg Hnh+
  Eucgr.D01809.1.p 128 LDDGYRWRKYGQKAVKNSGHPRSYYRCTHHTCTVKKQIQRLSTDSSIVVTTYEGIHNHP 186
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-32115186IPR003657WRKY domain
SuperFamilySSF1182909.29E-28122187IPR003657WRKY domain
PROSITE profilePS5081128.897123188IPR003657WRKY domain
SMARTSM007741.8E-36128187IPR003657WRKY domain
PfamPF031062.3E-25129186IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDGRVPAGPL PPPPQLPLAP AEYMFPCINP HLLPSTPLLH SPALMPPQAL DPQQFAMEVD  60
WFSLLSGSSK FAEHHPSPTN AFSSARGHNN RGEDVKNGGR SCNKKVGRTR KAIPPRVAFH  120
TKSADDILDD GYRWRKYGQK AVKNSGHPRS YYRCTHHTCT VKKQIQRLST DSSIVVTTYE  180
GIHNHPCEKL METLTPLLRQ LQLLSGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-24116185271WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01809.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053205.11e-155PREDICTED: probable WRKY transcription factor 24
SwissprotQ9FFS31e-55WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A059CHT41e-155A0A059CHT4_EUCGR; Uncharacterized protein
STRINGGLYMA16G03480.23e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-47WRKY DNA-binding protein 56